Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGABA receptor gamma-1 subunit
LigandBDBM50021186
Substrate/Competitorn/a
Meas. Tech.ChEBML_68602
IC50 400±n/a nM
Citation Krogsgaard-Larsen, PNielsen, LFalch, ECurtis, DR GABA agonists. Resolution, absolute stereochemistry, and enantioselectivity of (S)-(+)- and (R)-(-)-dihydromuscimol. J Med Chem28:1612-7 (1985) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GABA receptor gamma-1 subunit
Name:Benzodiazepine receptors; peripheral & central
Synonyms:Benzodiazepine receptors
Type:PROTEIN
Mol. Mass.:53557.84
Organism:Rattus norvegicus
Description:ChEMBL_193817
Residue:465
Sequence:
MGSGKVFLFSPSLLWSQTRGVRLIFLLLTLHLGNCIDKADDEDDEDLTMNKTWVLAPKIH
EGDITQILNSLLQGYDNKLRPDIGVRPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWF
DSRLKFNSTMKVLMLNSNMVGKIWIPDTFFRNSRKSDAHWITTPNRLLRIWSDGRVLYTL
RLTINAECYLQLHNFPMDEHSCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAF
VGLRNSTEISHTISGDYIIMTIFFDLSRRMGYFTIQTYIPCILTVVLSWVSFWINKDAVP
ARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALMEYGTLHYFTSN
NKGKTTRDRKLKSKTSVSPGLHAGSTLIPMNNISMPQGEDDYGYQCLEGKDCATFFCCFE
DCRTGSWREGRIHIRIAKIDSYSRIFFPTAFALFNLVYWVGYLYL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50021186
NameBDBM50021186
Synonyms:4-Amino-3-hydroxy-butyric acid | CHEMBL296263 | S(+)-4-amino-3-hydroxybutanoic acid
TypeSmall organic molecule
Emp. Form.C4H9NO3
Mol. Mass.119.1192
SMILESNC[C@@H](O)CC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a