Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRenin
LigandBDBM50022869
Substrate/Competitorn/a
Meas. Tech.ChEBML_195945
pH6±n/a
IC50 1500±n/a nM
Commentsextracted
Citation Luly, JRBolis, GBaMaung, NSoderquist, JDellaria, JFStein, HCohen, JPerun, TJGreer, JPlattner, JJ New inhibitors of human renin that contain novel Leu-Val replacements. Examination of the P1 site. J Med Chem31:532-9 (1988) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Renin
Name:Renin
Synonyms:Angiotensinogenase
Type:Enzyme
Mol. Mass.:45058.99
Organism:Homo sapiens (Human)
Description:n/a
Residue:406
Sequence:
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEW
SQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRL
YTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEM
PALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGG
QIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISG
STSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKK
LCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50022869
NameBDBM50022869
Synonyms:1N-[1-[1-(2-cyclohexylethyl)-2-hydroxy-3-isopropylsulfanyl-(1S,2R)-propylcarbamoyl]-2-(1H-5-imidazolyl)-(1S)-ethyl]-2-amino-tertiarybutyloxycarbonyl-3-phenyl-(2S)-propanamide | CHEMBL347741
TypeSmall organic molecule
Emp. Form.C34H53N5O5S
Mol. Mass.643.88
SMILESCC(C)SC[C@H](O)[C@H](CCC1CCCCC1)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@H](Cc1ccccc1)NC(=O)OC(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a