Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM50023499
Substrate/Competitorn/a
Meas. Tech.ChEBML_28547
IC50 89±n/a nM
Citation Francis, JECash, WDPsychoyos, SGhai, GWenk, PFriedmann, RCAtkins, CWarren, VFurness, PHyun, JL Structure-activity profile of a series of novel triazoloquinazoline adenosine antagonists. J Med Chem31:1014-20 (1988) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1
Name:Adenosine receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptors A1
Type:Protein
Mol. Mass.:36704.13
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:326
Sequence:
MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50023499
NameBDBM50023499
Synonyms:(9-Chloro-2-furan-2-yl-[1,2,4]triazolo[1,5-c]quinazolin-5-yl)-methyl-amine | CHEMBL8136
TypeSmall organic molecule
Emp. Form.C14H10ClN5O
Mol. Mass.299.715
SMILESCNc1nc2ccc(Cl)cc2c2nc(nn12)-c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a