Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCDGSH iron-sulfur domain-containing protein 1
LigandBDBM50103521
Substrate/Competitorn/a
Meas. Tech.ChEMBL_609914
IC50 1000±n/a nM
Citation Geldenhuys, WJFunk, MOBarnes, KFCarroll, RT Structure-based design of a thiazolidinedione which targets the mitochondrial protein mitoNEET. Bioorg Med Chem Lett20:819-23 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CDGSH iron-sulfur domain-containing protein 1
Name:CDGSH iron-sulfur domain-containing protein 1
Synonyms:CDGSH iron-sulfur domain-containing protein 1 | Cisd1 | MitoNEET
Type:PROTEIN
Mol. Mass.:12102.37
Organism:Rattus norvegicus
Description:ChEMBL_108443
Residue:108
Sequence:
MGLSSDSPVRVEWIAAVTFAAGTAALGYLAYKKFYAKESRTKAMVNLQIQKDNPKVVHAF
DMEDLGDKAVYCRCWRSKKFPFCDGAHIKHNEETGDNVGPLIIKKKET
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50103521
NameBDBM50103521
Synonyms:Actos | CHEBI:8228 | Duetact | PIOGLITAZONE | Pioglitazone | US10188639, Compound h-rac-pio | US11141411, Compound h-rac-pio
TypeSmall organic molecule
Emp. Form.C19H20N2O3S
Mol. Mass.356.439
SMILESCCc1ccc(CCOc2ccc(CC3SC(=O)NC3=O)cc2)nc1
Structure
n/a