Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCDGSH iron-sulfur domain-containing protein 1
LigandBDBM50350486
Substrate/Competitorn/a
Meas. Tech.ChEMBL_609914
IC50 900±n/a nM
Citation Geldenhuys, WJFunk, MOBarnes, KFCarroll, RT Structure-based design of a thiazolidinedione which targets the mitochondrial protein mitoNEET. Bioorg Med Chem Lett20:819-23 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CDGSH iron-sulfur domain-containing protein 1
Name:CDGSH iron-sulfur domain-containing protein 1
Synonyms:CDGSH iron-sulfur domain-containing protein 1 | Cisd1 | MitoNEET
Type:PROTEIN
Mol. Mass.:12102.37
Organism:Rattus norvegicus
Description:ChEMBL_108443
Residue:108
Sequence:
MGLSSDSPVRVEWIAAVTFAAGTAALGYLAYKKFYAKESRTKAMVNLQIQKDNPKVVHAF
DMEDLGDKAVYCRCWRSKKFPFCDGAHIKHNEETGDNVGPLIIKKKET
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50350486
NameBDBM50350486
Synonyms:CHEMBL602048
TypeSmall organic molecule
Emp. Form.C18H25NO3S
Mol. Mass.335.461
SMILESCC(C)(C)c1cc(Cc2sc(=O)[nH]c2O)cc(c1O)C(C)(C)C
Structure
n/a