Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetReverse transcriptase
LigandBDBM50483322
Substrate/Competitorn/a
Meas. Tech.ChEMBL_701790
IC50 1500±n/a nM
Citation Tang, JMaddali, KDreis, CDSham, YYVince, RPommier, YWang, Z N-3 Hydroxylation of Pyrimidine-2,4-diones Yields Dual Inhibitors of HIV Reverse Transcriptase and Integrase. ACS Med Chem Lett2:63-67 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Reverse transcriptase
Name:Reverse transcriptase
Synonyms:n/a
Type:Protein
Mol. Mass.:29598.37
Organism:Human immunodeficiency virus 1
Description:Q9WKE8
Residue:254
Sequence:
PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50483322
NameBDBM50483322
Synonyms:CHEMBL1651644
TypeSmall organic molecule
Emp. Form.C22H25N3O3
Mol. Mass.379.4522
SMILESCC(C)c1c(Cc2ccccc2)n(COCc2ccccc2)c(=O)n(N)c1=O
Structure
n/a