Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFK506-binding protein 1B
LigandBDBM50029194
Substrate/Competitorn/a
Meas. Tech.ChEMBL_154486
Ki 33±n/a nM
Citation Hu, MKBadger, ARich, DH Cyclosporin analogs modified in the 3,7,8-positions: substituent effects on peptidylprolyl isomerase inhibition and immunosuppressive activity are nonadditive. J Med Chem38:4164-70 (1995) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
FK506-binding protein 1B
Name:FK506-binding protein 1B
Synonyms:12.6 kDa FKBP | FKBP-12.6 | FKBP-1B | Immunophilin FKBP12.6 | PPIase FKBP1B | Peptidyl-prolyl cis-trans isomerase FKBP1B | Rotamase | h-FKBP-12
Type:PROTEIN
Mol. Mass.:11785.40
Organism:Homo sapiens (Human)
Description:ChEMBL_1458980
Residue:108
Sequence:
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGF
EEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50029194
NameBDBM50029194
Synonyms:15-Benzyl-30-ethyl-33-(1-hydroxy-2-methyl-hex-4-enyl)-6,9,18,24-tetraisobutyl-3,21-diisopropyl-1,4,7,10,12,19,25,28-octamethyl-1,4,7,10,13,16,19,22,25,28,31undecaaza-cyclotritriacontan-2,5,8,11,14,17,20,23,26,29,32-undecaone | CHEMBL2370711
TypeSmall organic molecule
Emp. Form.C68H115N11O12
Mol. Mass.1278.7072
SMILES[H][C@]1(C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@@H](Cc2ccccc2)NC(=O)[C@@H](CC(C)C)N(C)C(=O)[C@@H](NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C(=O)[C@H](CC)NC(=O)[C@]([H])([C@H](O)C(C)C\C=C\C)N(C)C1=O)C(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a