Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFK506-binding protein 1B
LigandBDBM50022815
Substrate/Competitorn/a
Meas. Tech.ChEMBL_154486
Ki 6.0±n/a nM
Citation Hu, MKBadger, ARich, DH Cyclosporin analogs modified in the 3,7,8-positions: substituent effects on peptidylprolyl isomerase inhibition and immunosuppressive activity are nonadditive. J Med Chem38:4164-70 (1995) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
FK506-binding protein 1B
Name:FK506-binding protein 1B
Synonyms:12.6 kDa FKBP | FKBP-12.6 | FKBP-1B | Immunophilin FKBP12.6 | PPIase FKBP1B | Peptidyl-prolyl cis-trans isomerase FKBP1B | Rotamase | h-FKBP-12
Type:PROTEIN
Mol. Mass.:11785.40
Organism:Homo sapiens (Human)
Description:ChEMBL_1458980
Residue:108
Sequence:
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGF
EEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50022815
NameBDBM50022815
Synonyms:(3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R,4E)-1-hydroxy-2-methylhex-4-en-1-yl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-bis(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecaazacyclotritriacontan-2,5,8,11,14,17,20,23,26,29,32-undecone | 30-Ethyl-33-((E)-1-hydroxy-2-methyl-hex-4-enyl)-6,9,18,24-tetraisobutyl-3,21-diisopropyl-1,4,7,10,12,15,19,28-octamethyl-1,4,7,10,13,16,19,22,25,28,31undecaaza-cyclotritriacontan-2,5,8,11,14,17,20,23,26,29,32-undecaone | 30-Ethyl-33-(1-hydroxy-2-methyl-hex-4-enyl)-6,9,18,24-tetraisobutyl-3,21-diisopropyl-1,4,7,10,12,15,19,25,28-nonamethyl-1,4,7,10,13,16,19,22,25,28,31undecaaza-cyclotritriacontan-2,5,8,11,14,17,20,23,26,29,32-undecaone | CYCLOSPORINE | Cyclosporin A | Cyclosporine A | Cyclosproine A | US10077289, Compound Cyclosporin A | US9138393, Cyclosporin A
TypeSmall organic molecule
Emp. Form.C62H111N11O12
Mol. Mass.1202.6112
SMILESCC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O)C(C)C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a