Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine Oxidase Type B (MAO-B)
LigandBDBM50029812
Substrate/Competitorn/a
Meas. Tech.ChEMBL_123927
IC50 1360±n/a nM
Citation Lebreton, LCuret, OGueddari, SMazouz, FBernard, SBurstein, CMilcent, R Selective and potent monoamine oxidase type B inhibitors: 2-substituted 5-aryltetrazole derivatives. J Med Chem38:4786-92 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoamine Oxidase Type B (MAO-B)
Name:Monoamine oxidase
Synonyms:Amine oxidase (flavin-containing) B | Amine oxidase [flavin-containing] B | MAOB | Monoamine oxidase | Monoamine oxidase B (MAO-B) | Monoamine oxidase B (rMAO-B) | Monoamine oxidase type B (MAOB) | Monoamine oxidase-B (MAO-B)
Type:Enzyme
Mol. Mass.:58469.65
Organism:Rattus norvegicus (rat)
Description:P19643
Residue:520
Sequence:
MSNKCDVIVVGGGISGMAAAKLLHDCGLSVVVLEARDRVGGRTYTIRNKNVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHFVKGKSYAFRGPFPPVWNPITYLDYNNLWR
TMDEMGQEIPSDAPWKAPLAEEWDYMTMKELLDKICWTNSTKQIATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFIGGSGQVSERIKDILGDRVKLERPVIHIDQ
TGENVVVKTLNHEIYEAKYVISAIPPVLGMKIHHSPPLPILRNQLITRVPLGSVIKCMVY
YKEPFWRKKDFCGTMVIEGEEAPIAYTLDDTKPDGSCAAIMGFILAHKARKLVRLTKEER
LRKLCELYAKVLNSQEALQPVHYEEKNWCEEQYSGGCYTAYFPPGILTQYGRVLRQPVGK
IFFAGTETASHWSGYMEGAVEAGERAAREILHAIGKIPEDEIWQPEPESVDVPARPITNT
FLERHLPSVPGLLKLLGLTTILSATALGFLAHKKGLFVRF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50029812
NameBDBM50029812
Synonyms:3-(5-Biphenyl-4-yl-tetrazol-2-yl)-propan-1-ol | CHEMBL144945
TypeSmall organic molecule
Emp. Form.C16H16N4O
Mol. Mass.280.3244
SMILESOCCCn1nnc(n1)-c1ccc(cc1)-c1ccccc1
Structure
n/a