Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProteinase-activated receptor 1
LigandBDBM50031389
Substrate/Competitorn/a
Meas. Tech.ChEMBL_209245
EC50 400000±n/a nM
Citation Feng, DMVeber, DFConnolly, TMCondra, CTang, MJNutt, RF Development of a potent thrombin receptor ligand. J Med Chem38:4125-30 (1995) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Proteinase-activated receptor 1
Name:Proteinase-activated receptor 1
Synonyms:Coagulation factor II receptor | PAR-1 | Proteinase activated receptor 1 | Proteinase-activated receptor 1 (PAR-1) | Thrombin receptor | Thrombin receptor/ Proteinase-activated receptor 1(Par-1)
Type:Protein
Mol. Mass.:47450.07
Organism:Homo sapiens (Human)
Description:P25116
Residue:425
Sequence:
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031389
NameBDBM50031389
Synonyms:(S)-2-{(S)-2-[(S)-2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-3-phenyl-propionylamino}-4-methyl-pentanoic acid [(S)-1-((S)-1-carbamoyl-4-guanidino-butylcarbamoyl)-3-methyl-butyl]-amide | CHEMBL132307
TypeSmall organic molecule
Emp. Form.C36H55N9O6
Mol. Mass.709.8786
SMILESCC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(N)=N)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a