Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-lactamase
LigandBDBM50033685
Substrate/Competitorn/a
Meas. Tech.ChEMBL_40543
IC50>20000±n/a nM
Citation Buynak, JDWu, KBachmann, BKhasnis, DHua, LNguyen, HKCarver, CL Synthesis and biological activity of 7-alkylidenecephems. J Med Chem38:1022-34 (1995) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-lactamase
Name:Beta-lactamase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:41306.67
Organism:Enterobacter cloacae
Description:ChEMBL_40258
Residue:381
Sequence:
MMRKSLCCALLLGISCSALATPVSEKQLAEVVANTITPLMKAQSVPGMAVAVIYQGKPHY
YTFGKADIAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISLDDAVTRYWPQLTGKQ
WQGIRMLDLATYTAGGLPLQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLFGA
LAVKPSGMPYEQAMTTRVLKPLKLDHTWINVPKAEEAHYAWGYRDGKAVRVSPGMLDAQA
YGVKTNVQDMANWVMANMAPENVADASLKQGIALAQSRYWRIGSMYQGLGWEMLNWPVEA
NTVVEGSDSKVALAPLPVAEVNPPAPPVKASWVHKTGSTGGFGSYVAFIPEKQIGIVMLA
NTSYPNPARVEAAYHILEALQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50033685
NameBDBM50033685
Synonyms:CHEMBL8290 | Sodium; (2R,5R)-3-[2-hydroxy-eth-(Z)-ylidene]-7-oxo-4-oxa-1-aza-bicyclo[3.2.0]heptane-2-carboxylate
TypeSmall organic molecule
Emp. Form.C8H8NO5
Mol. Mass.198.1534
SMILESOC\C=C1/O[C@@H]2CC(=O)N2[C@H]1C([O-])=O
Structure
n/a