Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1A
LigandBDBM50040158
Substrate/Competitorn/a
Meas. Tech.ChEMBL_578
Ki 16±n/a nM
Citation Lin, CHHaadsma-Svensson, SRLahti, RAMcCall, RBPiercey, MFSchreur, PJVon Voigtlander, PFSmith, MWChidester, CG Centrally acting serotonergic and dopaminergic agents. 1. Synthesis and structure-activity relationships of 2,3,3a,4,5,9b-hexahydro-1H-benz[e]indole derivatives. J Med Chem36:1053-68 (1993) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1A
Name:5-hydroxytryptamine receptor 1A
Synonyms:5-HT-1A | 5-HT1A | 5-hydroxytryptamine receptor 1A (5-HT-1A) | ADRB2RL1 | ADRBRL1 | Dopamine D2 receptor and serotonin 1a receptor | G-21 | HTR1A | Serotonin receptor 1A
Type:n/a
Mol. Mass.:46122.49
Organism:Homo sapiens (Human)
Description:n/a
Residue:422
Sequence:
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50040158
NameBDBM50040158
Synonyms:9-Methoxy-2-methyl-3-propyl-2,3,3a,4,5,9b-hexahydro-1H-benzo[e]indole | CHEMBL10561
TypeSmall organic molecule
Emp. Form.C17H25NO
Mol. Mass.259.3865
SMILESCCCN1[C@H](C)CC2[C@H]1CCc1cccc(OC)c21
Structure
n/a