Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-1 (MMP1)
LigandBDBM50043594
Substrate/Competitorn/a
Meas. Tech.ChEMBL_49514
Ki>10000±n/a nM
Citation Chapman, KTKopka, IEDurette, PLEsser, CKLanza, TJIzquierdo-Martin, MNiedzwiecki, LChang, BHarrison, RKKuo, DW Inhibition of matrix metalloproteinases by N-carboxyalkyl peptides. J Med Chem36:4293-301 (1994) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase-1 (MMP1)
Name:Matrix metalloproteinase (1 and 13)
Synonyms:Fibroblast collagenase | Interstitial collagenase | MMP1 | Matrix metalloproteinase-1 | Matrix metalloproteinase-1 (MMP-1)
Type:Enzyme
Mol. Mass.:54010.26
Organism:Homo sapiens (Human)
Description:
Residue:469
Sequence:
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN
YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY
PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50043594
NameBDBM50043594
Synonyms:1N-(2-methoxyphenyl)-2-[1-[1-amino-(1R)-ethylcarboxamido]-3-phenyl-(1S)-propylcarboxamido]-4-methyl-(2S)-pentanamide | CHEMBL137468
TypeSmall organic molecule
Emp. Form.C26H36N4O4
Mol. Mass.468.5884
SMILESCOc1ccccc1NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCc1ccccc1)NC(=O)[C@@H](C)N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a