Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene B4 receptor 1
LigandBDBM50037382
Substrate/Competitorn/a
Meas. Tech.ChEMBL_99827
Ki 4±n/a nM
Citation Daines, RAChambers, PAPendrak, IJakas, DRSarau, HMFoley, JJSchmidt, DBGriswold, DEMartin, LDTzimas, MN (E)-3-[[[[6-(2-carboxyethenyl)-5-[[8-(4- methoxyphenyl)octyl]oxy]-2-pyridinyl]-methyl]thio]methyl]benzoic acid: a novel high-affinity leukotriene B4 receptor antagonist. J Med Chem36:2703-5 (1993) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leukotriene B4 receptor 1
Name:Leukotriene B4 receptor 1
Synonyms:Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | LTB4-R 1 | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2Y purinoceptor 7 | P2Y7
Type:Enzyme Catalytic Domain
Mol. Mass.:37582.68
Organism:Homo sapiens (Human)
Description:Q15722
Residue:352
Sequence:
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50037382
NameBDBM50037382
Synonyms:5-{2-(2-Carboxy-ethyl)-3-[(E)-6-(4-methoxy-phenyl)-hex-5-enyloxy]-phenoxy}-pentanoic acid | 5-{2-(2-Carboxy-ethyl)-3-[6-(4-methoxy-phenyl)-hex-5-enyloxy]-phenoxy}-pentanoic acid (ONO-4057) | CHEMBL422420 | ONO 4057 | ONO-4057
TypeSmall organic molecule
Emp. Form.C27H34O7
Mol. Mass.470.5547
SMILESCOc1ccc(\C=C\CCCCOc2cccc(OCCCCC(O)=O)c2CCC(O)=O)cc1
Structure
n/a