Target
Protease
Ligand
BDBM50498814
Substrate
n/a
Meas. Tech.
ChEMBL_1523253
Ki
0.270000±n/a nM
Citation
 Ghosh, AKTakayama, JKassekert, LAElla-Menye, JRYashchuk, SAgniswamy, JWang, YFAoki, MAmano, MWeber, ITMitsuya, H Structure-based design, synthesis, X-ray studies, and biological evaluation of novel HIV-1 protease inhibitors containing isophthalamide-derived P2-ligands. Bioorg Med Chem Lett 25:4903-4909 (2015) [PubMed]  Article
Target
Name:
Protease
Synonyms:
n/a
Type:
Enzyme
Mol. Mass.:
10904.79
Organism:
Human immunodeficiency virus 1 (HIV-1)
Description:
Q9YQ12
Residue:
99
Sequence:
PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
  
Inhibitor
Name:
BDBM50498814
Synonyms:
CHEMBL3627876
Type:
Small organic molecule
Emp. Form.:
C35H45N3O8S
Mol. Mass.:
667.812
SMILES:
COC[C@H]1C[C@@H](O)CN1C(=O)c1cccc(c1)C(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc(OC)cc1 |r|
Structure:
Search PDB for entries with ligand similarity: