Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target60 kDa heat shock protein, mitochondrial
LigandBDBM50259708
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1617700
IC50>250000±n/a nM
Citation Abdeen, SSalim, NMammadova, NSummers, CMGoldsmith-Pestana, KMcMahon-Pratt, DSchultz, PGHorwich, ALChapman, EJohnson, SM Targeting the HSP60/10 chaperonin systems of Trypanosoma brucei as a strategy for treating African sleeping sickness. Bioorg Med Chem Lett26:5247-5253 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
60 kDa heat shock protein, mitochondrial
Name:60 kDa heat shock protein, mitochondrial
Synonyms:3.6.4.9 | 60 kDa chaperonin | 60 kDa heat shock protein, mitochondrial | CPN60 | Chaperonin 60 | HSP-60 | HSP60 | HSP60/HSP10 | HSPD1 | Heat shock protein 60 | HuCHA60 | Mitochondrial matrix protein P1 | P60 lymphocyte protein
Type:PROTEIN
Mol. Mass.:61050.41
Organism:Homo sapiens
Description:ChEMBL_117701
Residue:573
Sequence:
MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGR
TVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLA
RSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDK
EIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQ
DAYVLLSEKKISSIQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAV
KAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKG
KGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDR
VTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIA
KNAGVEGSLIVEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLT
TAEVVVTEIPKEEKDPGMGAMGGMGGGMGGGMF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50259708
NameBDBM50259708
Synonyms:BAY-2502 | BAY-A2502 | BAYER-2502 | CHEBI:7566 | DNDI1613515 | Lampit | NIFURTIMOX | Nifurtimox
TypeSmall organic molecule
Emp. Form.C10H13N3O5S
Mol. Mass.287.292
SMILESCC1CS(=O)(=O)CCN1\N=C\c1ccc(o1)[N+]([O-])=O
Structure
n/a