Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50053908
Substrate/Competitorn/a
Meas. Tech.ChEMBL_157546
Ki 0.2±n/a nM
Citation Romines, KRMorris, JKHowe, WJTomich, PKHorng, MMChong, KTHinshaw, RRAnderson, DJStrohbach, JWTurner, SRMizsak, SA Cycloalkylpyranones and cycloalkyldihydropyrones as HIV protease inhibitors: exploring the impact of ring size on structure-activity relationships. J Med Chem39:4125-30 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50053908
NameBDBM50053908
Synonyms:4-Cyano-N-{3-[1-(4-hydroxy-2-oxo-4a,5,6,7,8,9,10,10a-octahydro-2H-cycloocta[b]pyran-3-yl)-2,2-dimethyl-propyl]-phenyl}-benzenesulfonamide | CHEMBL336746
TypeSmall organic molecule
Emp. Form.C29H34N2O5S
Mol. Mass.522.656
SMILESCC(C)(C)C(C1C(=O)OC2CCCCCCC2C1=O)c1cccc(NS(=O)(=O)c2ccc(cc2)C#N)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a