Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInosine Monophosphate Dehydrogenase Type 2 (IMPDH2)
LigandBDBM19264
Substrate/Competitorn/a
Meas. Tech.ChEMBL_89807
pH8±n/a
IC50 25±n/a nM
Commentsextracted
Citation Nelson, PHCarr, SFDevens, BHEugui, EMFranco, FGonzalez, CHawley, RCLoughhead, DGMilan, DJPapp, EPatterson, JWRouhafza, SSjogren, EBSmith, DBStephenson, RATalamas, FXWaltos, AMWeikert, RJWu, JC Structure-activity relationships for inhibition of inosine monophosphate dehydrogenase by nuclear variants of mycophenolic acid. J Med Chem39:4181-96 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Inosine Monophosphate Dehydrogenase Type 2 (IMPDH2)
Name:Inosine-5'-monophosphate dehydrogenase (IMPDH)
Synonyms:IMP dehydrogenase 2 | IMPD 2 | IMPDH-II | Inosine 5'-monophosphate dehydrogenase II (IMPDH II) | Inosine-5 -monophosphate dehydrogenase 2 | Inosine-5''''-monophosphate dehydrogenase 2
Type:Enzyme
Mol. Mass.:55806.87
Organism:Homo sapiens (Human)
Description:Recombinant IMPDH2 expressed in E. coli.
Residue:514
Sequence:
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVV
LSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMT
KREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDA
KKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVI
GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVP
VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVR
AMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19264
NameBDBM19264
Synonyms:(4E)-6-(4-hydroxy-6-methoxy-7-methyl-3-oxo-1,3-dihydro-2-benzofuran-5-yl)-4-methylhex-4-enoic acid | (E)-6-(4-hydroxy-6-methoxy-7-methyl-3-oxo-1H-2-benzofuran-5-yl)-4-methylhex-4-enoic acid | CHEMBL866 | MPA (1) | Mycophenolic Acid (MPA) | Myfortic
TypeSmall organic molecule
Emp. Form.C17H20O6
Mol. Mass.320.3371
SMILESCOc1c(C)c2COC(=O)c2c(O)c1C\C=C(/C)CCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a