Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM50001915
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1163
Ki 130±n/a nM
Citation López-Rodríguez, MLRosado, MLBenhamú, BMorcillo, MJSanz, AMOrensanz, LBeneitez, MEFuentes, JAManzanares, J Synthesis and structure-activity relationships of a new model of arylpiperazines. 1. 2-[[4-(o-methoxyphenyl)piperazin-1-yl]methyl]-1, 3-dioxoperhydroimidazo[1,5-alpha]pyridine: a selective 5-HT1A receptor agonist. J Med Chem39:4439-50 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin (5-HT) receptor
Name:Serotonin 1 (5-HT1) receptor
Synonyms:5-HT-1A | 5-HT1 | 5-HT1A | 5-Hydroxytryptamine receptor 1A (5-HT1A) | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5HT1A) | G-21 | Serotonin 1a (5-HT1a) receptor/Adrenergic receptor alpha-1 | Serotonin receptor 1A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:46445.29
Organism:Rattus norvegicus (rat)
Description:Binding assays were performed using rat hippocampal membranes.
Residue:422
Sequence:
MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKVEKKGAGT
SLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGN
SKEHLPLPSESGSNSYAPACLERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001915
NameBDBM50001915
Synonyms:1-(3-chlorophenyl)piperazine | CHEMBL478 | m-Chlorophenylpiperazine | mCPP
TypeSmall organic molecule
Emp. Form.C10H13ClN2
Mol. Mass.196.677
SMILESClc1cccc(c1)N1CCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a