Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(3) dopamine receptor
LigandBDBM50056442
Substrate/Competitorn/a
Meas. Tech.ChEMBL_62921
Ki 2459±n/a nM
Citation Heier, RFDolak, LADuncan, JNHyslop, DKLipton, MFMartin, IJMauragis, MAPiercey, MFNichols, NFSchreur, PJSmith, MWMoon, MW Synthesis and biological activities of (R)-5,6-dihydro-N,N-dimethyl-4H-imidazo[4,5,1-ij]quinolin-5-amine and its metabolites. J Med Chem40:639-46 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(3) dopamine receptor
Name:D(3) dopamine receptor
Synonyms:D2-like dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3
Type:n/a
Mol. Mass.:44243.43
Organism:Homo sapiens (Human)
Description:n/a
Residue:400
Sequence:
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50056442
NameBDBM50056442
Synonyms:(R)-5,6-Dihydro-4H-imidazo[4,5,1-ij]quinolin-5-yl-methyl-amine | CHEMBL348285
TypeSmall organic molecule
Emp. Form.C11H13N3
Mol. Mass.187.241
SMILESCN[C@@H]1Cc2cccc3ncn(C1)c23
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a