Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1A (5-HT1A)
LigandBDBM50056445
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1548
Ki 0.4±n/a nM
Citation Heier, RFDolak, LADuncan, JNHyslop, DKLipton, MFMartin, IJMauragis, MAPiercey, MFNichols, NFSchreur, PJSmith, MWMoon, MW Synthesis and biological activities of (R)-5,6-dihydro-N,N-dimethyl-4H-imidazo[4,5,1-ij]quinolin-5-amine and its metabolites. J Med Chem40:639-46 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1A (5-HT1A)
Name:5-hydroxytryptamine receptor 1A (5-HT1A)
Synonyms:5-HT-1A | 5-HT1A | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5-HT-1A) | ADRB2RL1 | ADRBRL1 | Dopamine D2 receptor and serotonin 1a receptor | G-21 | HTR1A | Serotonin receptor 1A
Type:n/a
Mol. Mass.:46122.49
Organism:Homo sapiens (Human)
Description:n/a
Residue:422
Sequence:
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50056445
NameBDBM50056445
Synonyms:1,1-diethyl-3-[(8alpha)-6-methyl-9,10-didehydroergolin-8-yl]urea | CHEMBL157138 | N'-((8alpha)-9,10-Didehydro-6-methylergolin-8-yl)-N,N-diethylurea | lisuride | lisuride, (S)
TypeSmall organic molecule
Emp. Form.C20H26N4O
Mol. Mass.338.4466
SMILESCCN(CC)C(=O)N[C@@H]1CN(C)[C@@H]2Cc3c[nH]c4cccc(C2=C1)c34 |c:23|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a