Target
G-protein coupled receptor 84
Ligand
BDBM50511048
Substrate
n/a
Meas. Tech.
ChEMBL_1843332
Ki
37±n/a nM
Citation
 Köse, MPillaiyar, TNamasivayam, VDe Filippo, ESylvester, KUlven, Tvon Kügelgen, IMüller, CE An Agonist Radioligand for the Proinflammatory Lipid-Activated G Protein-Coupled Receptor GPR84 Providing Structural Insights. J Med Chem 63:2391-2410 (2020) [PubMed]  Article
Target
Name:
G-protein coupled receptor 84
Synonyms:
EX33 | G-protein coupled receptor 84 | GPR84 | Inflammation-related G-protein coupled receptor EX33
Type:
PROTEIN
Mol. Mass.:
43726.73
Organism:
Homo sapiens (Human)
Description:
ChEMBL_116040
Residue:
396
Sequence:
MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIANLTLADLLYCTLLQPFSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYLLIAHPKLFPQVFSAKGIVLALVSTWVVGVASFAPLWPIYILVPVVCTCSFDRIRGRPYTTILMGIYFVLGLSSVGIFYCLIHRQVKRAAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRVVHMLAANLTWLNGCINPVLYAAMNRQFRQAYGSILKRGPRSFHRLH
  
Inhibitor
Name:
BDBM50511048
Synonyms:
CHEMBL4462370
Type:
Small organic molecule
Emp. Form.:
C12H20N4O3
Mol. Mass.:
268.3122
SMILES:
CCCCCCCCNc1[nH]c(=O)[nH]c(=O)c1N=O
Structure:
Search PDB for entries with ligand similarity: