Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChymase
LigandBDBM50068887
Substrate/Competitorn/a
Meas. Tech.ChEBML_49442
Ki 6.8±n/a nM
Citation Eda, MAshimori, AAkahoshi, FYoshimura, TInoue, YFukaya, CNakajima, MFukuyama, HImada, TTakai, SShiota, NMiyazaki, MNakamura, N Peptidyl human heart chymase inhibitors. 1. Synthesis and inhibitory activity of difluoromethylene ketone derivatives bearing P' binding subsites. Bioorg Med Chem Lett8:913-8 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Chymase
Name:Chymase
Synonyms:Alpha-chymase | Chymase precursor | Mast cell protease I
Type:Enzyme
Mol. Mass.:27340.12
Organism:Homo sapiens (Human)
Description:n/a
Residue:247
Sequence:
MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50068887
NameBDBM50068887
Synonyms:4-(4-{[(S)-1-((S)-2-tert-Butoxycarbonylamino-3-methyl-butyryl)-pyrrolidine-2-carbonyl]-amino}-2,2-difluoro-3-oxo-5-phenyl-pentanoylamino)-benzoic acid | CHEMBL170879
TypeSmall organic molecule
Emp. Form.C33H40F2N4O8
Mol. Mass.658.6895
SMILESCC(C)[C@H](NC(=O)OC(C)(C)C)C(=O)N1CCC[C@H]1C(=O)NC(Cc1ccccc1)C(=O)C(F)(F)C(=O)Nc1ccc(cc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a