Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin-1
LigandBDBM50070824
Substrate/Competitorn/a
Meas. Tech.ChEBML_210683
Ki 2600±n/a nM
Citation Isaacs, RCCutrona, KJNewton, CLSanderson, PESolinsky, MGBaskin, EPChen, IWCooper, CMCook, JJGardell, SJLewis, SDLucas, RJLyle, EALynch, JJNaylor-Olsen, AMStranieri, MTVastag, KVacca, JP C6 modification of the pyridinone core of thrombin inhibitor L-374,087 as a means of enhancing its oral absorption. Bioorg Med Chem Lett8:1719-24 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Trypsin-1
Name:Trypsin-1
Synonyms:Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | Trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:26557.80
Organism:Homo sapiens (Human)
Description:P07477
Residue:247
Sequence:
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50070824
NameBDBM50070824
Synonyms:CHEMBL47920 | N-(6-Amino-2-methyl-pyridin-3-ylmethyl)-2-[3-(4-chloro-phenylmethanesulfonylamino)-6-methyl-2-oxo-2H-pyridin-1-yl]-acetamide
TypeSmall organic molecule
Emp. Form.C22H24ClN5O4S
Mol. Mass.489.975
SMILESCc1ccc(NS(=O)(=O)Cc2ccc(Cl)cc2)c(=O)n1CC(=O)NCc1ccc(N)nc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a