Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman herpes virus 5 capsid protein P40
LigandBDBM50073405
Substrate/Competitorn/a
Meas. Tech.ChEBML_158972
IC50>34000±n/a nM
Citation Dhanak, DKeenan, RMBurton, GKaura, ADarcy, MGShah, DHRidgers, LHBreen, ALavery, PTew, DGWest, A Benzothiopyran-4-one based reversible inhibitors of the human cytomegalovirus (HCMV) protease. Bioorg Med Chem Lett8:3677-82 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human herpes virus 5 capsid protein P40
Name:Human herpes virus 5 capsid protein P40
Synonyms:Assemblin | Assembly protein | Capsid protein P40 | Protease precursor | pPR
Type:PROTEIN
Mol. Mass.:73854.16
Organism:Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)
Description:ChEMBL_158958
Residue:708
Sequence:
MTMDEQQSQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLHAQGQGQPSLSVALPLN
INHDDTAVVGHVAAMQSVRDGLFCLGCVTSPRFLEIVRRASEKSELVSRGPVSPLQPDKV
VEFLSGSYAGLSLSSRRCDDVEAATSLSGSETTPFKHVALCSVGRRRGTLAVYGRDPEWV
TQRFPDLTAADRDGLRAQWQRCGSTAVDASGDPFRSDSYGLLGNSVDALYIRERLPKLRY
DKQLVGVTERESYVKASVSPEAACDIKAASAERSGDSRSQAATPAAGARVPSSSPSPPVE
PPSPVQPPALPASPSVLPAESPPSLSPSEPAEAASMSHPLSAAVPAATAPPGATVAGASP
AVSSLAWPHDGVYLPKDAFFSLLGASRSAVPVMYPGAVAAPPSASPAPLPLPSYPASYGA
PVVGYDQLAARHFADYVDPHYPGWGRRYEPAPSLHPSYPVPPPPSPAYYRRRDSPGGMDE
PPSGWERYDGGHRGQSQKQHRHGGSGGHNKRRKETAAASSSSSDEDLSFPGEAEHGRARK
RLKSHVNSDGGSGGHAGSNQQQQQRYDELRDAIHELKRDLFAARQSSTLLSAALPSAASS
SPTTTTVCTPTGELTSGGGETPTALLSGGAKVAERAQAGVVNASCRLATASGSEAATAGP
STAGSSSCPASVVLAAAAAQAAAASQSPPKDMVDLNRRIFVAALNKLE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50073405
NameBDBM50073405
Synonyms:2-(4-Methanesulfonyl-phenyl)-thiochromen-4-one | CHEMBL421075
TypeSmall organic molecule
Emp. Form.C16H12O3S2
Mol. Mass.316.395
SMILESCS(=O)(=O)c1ccc(cc1)-c1cc(=O)c2ccccc2s1
Structure
n/a