Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOxytocin receptor
LigandBDBM50077041
Substrate/Competitorn/a
Meas. Tech.ChEBML_149179
Ki 1.2±n/a nM
Citation Williams, PDBock, MGEvans, BEFreidinger, RMGallicchio, SNGuidotti, MTJacobson, MAKuo, MSLevy, MRLis, EVMichelson, SRPawluczyk, JMPerlow, DSPettibone, DJQuigley, AGReiss, DRSalvatore, CStauffer, KJWoyden, CJ Nonpeptide oxytocin antagonists: analogs of L-371,257 with improved potency. Bioorg Med Chem Lett9:1311-6 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Oxytocin receptor
Name:Oxytocin receptor
Synonyms:OT-R | Oxytocin
Type:Enzyme Catalytic Domain
Mol. Mass.:42889.28
Organism:RAT
Description:Oxytocin OXTR RAT::P70536
Residue:388
Sequence:
MEGTPAANWSVELDLGSGVPPGEEGNRTAGPPQRNEALARVEVAVLCLILFLALSGNACV
LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLGTWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYVTWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA
AAEGNDAAGGAGRAALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWD
VNAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQRFFCCSARYLKGSRPGETS
VSKKSNSSTFVLSRRSSSQRSCSQPSSA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50077041
NameBDBM50077041
Synonyms:1-(1-{2-[4-(1-Cyclopropylmethyl-piperidin-4-yloxy)-2-(2,2,2-trifluoro-ethoxy)-phenyl]-acetyl}-piperidin-4-yl)-1,4-dihydro-benzo[d][1,3]oxazin-2-one | CHEMBL24456
TypeSmall organic molecule
Emp. Form.C32H38F3N3O5
Mol. Mass.601.6564
SMILESFC(F)(F)COc1cc(OC2CCN(CC3CC3)CC2)ccc1CC(=O)N1CCC(CC1)N1C(=O)OCc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a