Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTryptase
LigandBDBM50083548
Substrate/Competitorn/a
Meas. Tech.ChEMBL_210823
Ki 0.057000±n/a nM
Citation Ono, SKuwahara, STakeuchi, MSakashita, HNaito, YKondo, T Syntheses and evaluation of amidinobenzofuran derivatives as tryptase inhibitors. Bioorg Med Chem Lett9:3285-90 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tryptase
Name:Tryptase
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 1510505
Components:This complex has 3 components.
Component 1
Name:Tryptase
Synonyms:Serine protease 31 | Transmembrane tryptase | Tryptase gamma | Tryptase gamma heavy chain | Tryptase gamma light chain
Type:PROTEIN
Mol. Mass.:33817.52
Organism:Homo sapiens (Human)
Description:ChEMBL_210833
Residue:321
Sequence:
MALGACGLLLLLAVPGVSLRTLQPGCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRRM
HVCGGSLLSPQWVLTAAHCFSGSLNSSDYQVHLGELEITLSPHFSTVRQIILHSSPSGQP
GTSGDIALVELSVPVTLSSRILPVCLPEASDDFCPGIRCWVTGWGYTREGEPLPPPYSLR
EVKVSVVDTETCRRDYPGPGGSILQPDMLCARGPGDACQDDSGGPLVCQVNGAWVQAGTV
SWGEGCGRPNRPGVYTRVPAYVNWIRRHITASGGSESGYPRLPLLAGLFLPGLFLLLVSC
VLLAKCLLHPSADGTPFPAPD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Tryptase
Synonyms:Tryptase II | Tryptase beta-1 | Tryptase beta-2 | Tryptase-2
Type:PROTEIN
Mol. Mass.:30518.79
Organism:Homo sapiens (Human)
Description:ChEMBL_210702
Residue:275
Sequence:
MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCG
GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA
DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV
PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG
VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 3
Name:Tryptase delta
Synonyms:Delta-tryptase | HmMCP-3-like tryptase III | Mast cell mMCP-7-like | TPSD1 | Tryptase delta | Tryptase-3
Type:PROTEIN
Mol. Mass.:26578.73
Organism:Homo sapiens (Human)
Description:ChEMBL_104777
Residue:242
Sequence:
MLLLAPQMLSLLLLALPVLASPAYVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRVRGP
YWMHFCGGSLIHPQWVLTAAHCVEPDIKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQF
YIIQTGADIALLELEEPVNISSHIHTVTLPPASETFPPGMPCWVTGWGDVDNNVHLPPPY
PLKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRDDMLCAGSENHDSCQGDSGGPLVCKVN
GT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50083548
NameBDBM50083548
Synonyms:1-{4-[5-amino(imino)methylbenzo[b]furan-2-ylcarbonyl]hexahydro-1-pyrazinyl}-2-[4-(2-{4-[5-amino(imino)methylbenzo[b]furan-2-ylcarbonyl]hexahydro-1-pyrazinyl}-2-oxoethoxy)phenoxy]-1-ethanone | CHEMBL322345
TypeSmall organic molecule
Emp. Form.C38H38N8O8
Mol. Mass.734.7571
SMILESNC(=N)c1ccc2oc(cc2c1)C(=O)N1CCN(CC1)C(=O)COc1ccc(OCC(=O)N2CCN(CC2)C(=O)c2cc3cc(ccc3o2)C(N)=N)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a