Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-1 Adrenergic Receptor/ adrenergic receptor/ adrenergic receptor
LigandBDBM50085679
Substrate/Competitorn/a
Meas. Tech.ChEMBL_32551
Ki 91±n/a nM
Citation Ross, TMJetter, MCMcDonnell, MEBoyd, REConnelly, CDMartinez, RPLewis, MACodd, EERaffa, RBReitz, AB alpha(2) Adrenoceptor agonists as potential analgesic agents. 2. Discovery of 4-(4-Imidazo)-1,3-dimethyl-6,7-dihydrothianaphthene [corrected] as a high-affinity ligand for the alpha(2D) adrenergic receptor. J Med Chem43:765-8 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-1 Adrenergic Receptor/ adrenergic receptor/ adrenergic receptor
Name:Alpha-1 Adrenergic Receptor/ adrenergic receptor/ adrenergic receptor
Synonyms:Adrenergic receptor alpha-1 | alpha-1 Adrenergic Receptor
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 303470
Components:This complex has 3 components.
Component 1
Name:Alpha adrenergic receptor 1A and 1B
Synonyms:Alpha 1B-adrenoceptor | Alpha 1B-adrenoreceptor | Alpha-1 Adrenergic Receptor | Alpha-1Adrenoceptor | Alpha-1B adrenergic receptor | Alpha-1B adrenoreceptor | adrenergic Alpha1B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:56606.71
Organism:Rattus norvegicus (rat)
Description:Receptor binding assays were performed using rat cortical membranes.
Residue:515
Sequence:
MNPDLDTGHNTSAPAHWGELKDDNFTGPNQTSSNSTLPQLDVTRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFM
RILGCQCRGGRRRRRRRRLGACAYTYRPWTRGGSLERSQSRKDSLDDSGSCMSGTQRTLP
SASPSPGYLGRGTQPPVELCAFPEWKPGALLSLPEPPGRRGRLDSGPLFTFKLLGDPESP
GTEGDTSNGGCDTTTDLANGQPGFKSNMPLAPGHF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Alpha adrenergic receptor 1A and 1B
Synonyms:Adrenaline | Adrenaline 1 | Alpha-1 adrenoreceptor | adrenergic Alpha1A
Type:Protein
Mol. Mass.:51620.15
Organism:Rattus norvegicus (Rat)
Description:P43140
Residue:466
Sequence:
MVLLSENASEGSNCTHPPAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGVRALLCVWVLSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYVPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
VPAEGGGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQSSKHALGYTL
HPPSQALEGQHRDMVRIPVGSGETFYKISKTDGVCEWKFFSSMPQGSARITVPKDQSACT
TARVRSKSFLQVCCCVGSSAPRPEENHQVPTIKIHTISLGENGEEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 3
Name:Alpha adrenergic receptor 1A and 1D
Synonyms:Alpha adrenergic receptor 1A and 1D | Serotonin 1a (5-HT1a) receptor/Adrenergic receptor alpha-1
Type:Protein
Mol. Mass.:59375.97
Organism:Rattus norvegicus (Rat)
Description:P23944
Residue:561
Sequence:
MTFRDILSVTFEGPRSSSSTGGSGAGGGAGTVGPEGGAVGGVPGATGGGAVVGTGSGEDN
QSSTGEPGAAASGEVNGSAAVGGLVVSAQGVGVGVFLAAFILTAVAGNLLVILSVACNRH
LQTVTNYFIVNLAVADLLLSAAVLPFSATMEVLGFWAFGRTFCDVWAAVDVLCCTASILS
LCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWAVALVVSVGPLLGWKEPVPPDERFC
GITEEVGYAIFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGIKREPGKASEVVLRI
HCRGAATSAKGYPGTQSSKGHTLRSSLSVRLLKFSREKKAAKTLAIVVGVFVLCWFPFFF
VLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQCRRRRR
RLWAVYGHHWRASTGDARSDCAPSPRIAPPGAPLALTAHPGAGSADTPETQDSVSSSRKP
ASALREWRLLGPLQRPTTQLRAKVSSLSHKIRSGARRAETACALRSEVEAVSLNVPQDGA
EAVICQAYEPGDYSNLRETDI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50085679
NameBDBM50085679
Synonyms:4-(4,5,6,7-Tetrahydro-benzo[b]thiophen-7-yl)-1H-imidazole | CHEMBL286269
TypeSmall organic molecule
Emp. Form.C11H12N2S
Mol. Mass.204.291
SMILESC1CC(c2cnc[nH]2)c2sccc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a