Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-2A adrenergic receptor
LigandBDBM50016897
Substrate/Competitorn/a
Meas. Tech.ChEMBL_33079
Ki 853±n/a nM
Citation Ross, TMJetter, MCMcDonnell, MEBoyd, REConnelly, CDMartinez, RPLewis, MACodd, EERaffa, RBReitz, AB alpha(2) Adrenoceptor agonists as potential analgesic agents. 2. Discovery of 4-(4-Imidazo)-1,3-dimethyl-6,7-dihydrothianaphthene [corrected] as a high-affinity ligand for the alpha(2D) adrenergic receptor. J Med Chem43:765-8 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-2A adrenergic receptor
Name:Adenosine receptor A1/Alpha-2A adrenergic receptor
Synonyms:Adrenergic alpha2A | Adrenergic receptor alpha | Alpha-2 adrenergic receptor subtype C10 | Alpha-2A adrenoceptor | Alpha-2A adrenoreceptor | Alpha-2AAR | alpha-2A adrenergic receptor [Homo sapiens]
Type:Enzyme
Mol. Mass.:48979.91
Organism:Homo sapiens (Human)
Description:P08913
Residue:450
Sequence:
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGG
PQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVA
APPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSD
HAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50016897
NameBDBM50016897
Synonyms:2-(2,6-dichloroanilino)-1,3-diazacyclopentene-(2) | 2-(2,6-dichloroanilino)-2-imidazoline | CLONIDINE | N-(2,6-dichlorophenyl)-4,5-dihydro-1H-imidazol-2-amine | clonidine (amino form)
TypeSmall organic molecule
Emp. Form.C9H9Cl2N3
Mol. Mass.230.094
SMILESClc1cccc(Cl)c1\[#7]=[#6]-1\[#7]-[#6]-[#6]-[#7]-1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a