Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A3
LigandBDBM50086137
Substrate/Competitorn/a
Meas. Tech.ChEMBL_31868
Ki 25±n/a nM
Citation Colotta, VCatarzi, DVarano, FCecchi, LFilacchioni, GMartini, CTrincavelli, LLucacchini, A 1,2,4-Triazolo[4,3-a]quinoxalin-1-one: a versatile tool for the synthesis of potent and selective adenosine receptor antagonists. J Med Chem43:1158-64 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A3
Name:Adenosine receptor A3
Synonyms:A3 adenosine receptor (hA3) | Adenosine A3 receptor (A3AR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36197.32
Organism:Homo sapiens (Human)
Description:P0DMS8
Residue:318
Sequence:
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50086137
NameBDBM50086137
Synonyms:2-p-Tolyl-2H,5H-[1,2,4]triazolo[4,3-a]quinoxaline-1,4-dione | CHEMBL279410
TypeSmall organic molecule
Emp. Form.C16H12N4O2
Mol. Mass.292.2921
SMILESCc1ccc(cc1)-n1nc2n(c3ccccc3[nH]c2=O)c1=O
Structure
n/a