Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADRA1B
LigandBDBM50033111
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30103
Ki 0.69±n/a nM
Citation Meyer, MDAltenbach, RJBasha, FZCarroll, WACondon, SElmore, SWKerwin, JFSippy, KBTietje, KWendt, MDHancock, AABrune, MEBuckner, SADrizin, I Structure-activity studies for a novel series of tricyclic substituted hexahydrobenz[e]isoindole alpha(1A) adrenoceptor antagonists as potential agents for the symptomatic treatment of benign prostatic hyperplasia (BPH). J Med Chem43:1586-603 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ADRA1B
Name:ADRA1B
Synonyms:Adrenergic receptor alpha | Alpha-1b adrenergic receptor | adrenergic Alpha1B
Type:Enzyme Catalytic Domain
Mol. Mass.:56514.13
Organism:C.H.O.
Description:adrenergic Alpha1B ADRA1B C.H.O.::P18841
Residue:515
Sequence:
MNPDLDTGHNTSAPAQWGELKDANFTGPNQTSSNSTLPQLDVTRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFM
RILGCQCRSGRRRRRRRRLGACAYTYRPWTRGGSLERSQSRKDSLDDSGSCMSGSQRTLP
SASPSPGYLGRGAQPPLELCAYPEWKSGALLSLPEPPGRRGRLDSGPLFTFKLLGEPESP
GTEGDASNGGCDATTDLANGQPGFKSNMPLAPGHF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50033111
NameBDBM50033111
Synonyms:1-(4-Amino-6,7-dimethoxy-2-quinazolinyl)-4-((tetrahydro-2-furanyl)carbonyl)piperazine | 6,7-dimethoxy-2-[4-(tetrahydrofuran-2-ylcarbonyl)piperazin-1-yl]quinazolin-4-amine | CHEMBL611 | TERAZOSIN | Terazosine
TypeSmall organic molecule
Emp. Form.C19H25N5O4
Mol. Mass.387.4329
SMILESCOc1cc2nc(nc(N)c2cc1OC)N1CCN(CC1)C(=O)C1CCCO1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a