Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndothelin receptor, ET-A/ET-B
LigandBDBM50146710
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1923368
IC50 195±n/a nM
Citation Boss, CBolli, MHGatfield, J From bosentan (TracleerŪ) to macitentan (OpsumitŪ): The medicinal chemistry perspective. Bioorg Med Chem Lett26:3381-94 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Endothelin receptor, ET-A/ET-B
Name:Endothelin receptor, ET-A/ET-B
Synonyms:ENDOTHELIN B | ET-B | Endothelin receptor ET-B | Endothelin receptor non-selective type | Endothelin receptor, ET-A/ET-B
Type:Enzyme Catalytic Domain
Mol. Mass.:49664.00
Organism:Homo sapiens (Human)
Description:ENDOTHELIN B EDNRB HUMAN::P24530
Residue:442
Sequence:
MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNA
SLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNS
TLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFI
QKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGF
DIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM
LRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCEL
LSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSC
LKFKANDHGYDNFRSSNKYSSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50146710
NameBDBM50146710
Synonyms:(S)-2-(4,6-Dimethyl-pyrimidin-2-yloxy)-3-methoxy-3,3-diphenyl-propionic acid | AMBRISENTAN | CHEMBL1111 | Letairis
TypeSmall organic molecule
Emp. Form.C22H22N2O4
Mol. Mass.378.4211
SMILESCOC([C@H](Oc1nc(C)cc(C)n1)C(O)=O)(c1ccccc1)c1ccccc1
Structure
n/a