Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin
LigandBDBM50088946
Substrate/Competitorn/a
Meas. Tech.ChEBML_212533
Ki 14±n/a nM
Citation Zhao, ZArnaiz, DOGriedel, BSakata, SDallas, JLWhitlow, MTrinh, LPost, JLiang, AMorrissey, MMShaw, KJ Design, synthesis, and in vitro biological activity of benzimidazole based factor Xa inhibitors. Bioorg Med Chem Lett10:963-6 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Trypsin
Name:Trypsin I
Synonyms:Beta-Trypsin | Cationic trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:25790.52
Organism:Bos taurus (bovine)
Description:P00760
Residue:246
Sequence:
MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50088946
NameBDBM50088946
Synonyms:3-{1-(7-Carbamimidoyl-naphthalen-2-ylmethyl)-5-[1-(1-imino-ethyl)-piperidin-4-yloxy]-1H-benzoimidazol-2-yl}-propionic acid | CHEMBL369159
TypeSmall organic molecule
Emp. Form.C29H32N6O3
Mol. Mass.512.6028
SMILESCC(=N)N1CCC(CC1)Oc1ccc2n(Cc3ccc4ccc(cc4c3)C(N)=N)c(CCC(O)=O)nc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a