Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine kinase
LigandBDBM50090872
Substrate/Competitorn/a
Meas. Tech.ChEMBL_31116
IC50 200±n/a nM
Citation Ugarkar, BGCastellino, AJDaRe, JMKopcho, JJWiesner, JBSchanzer, JMErion, MD Adenosine kinase inhibitors. 2. Synthesis, enzyme inhibition, and antiseizure activity of diaryltubercidin analogues. J Med Chem43:2894-905 (2000) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine kinase
Name:Adenosine kinase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:40545.97
Organism:Homo sapiens (Human)
Description:ChEMBL_1467841
Residue:362
Sequence:
MAAAEEEPKPKKLKVEAPQALRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAED
KHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKA
AEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKAR
VCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGN
ETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFA
VLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPD
FH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50090872
NameBDBM50090872
Synonyms:2-[4-(4-Hydroxy-phenylamino)-5-iodo-pyrrolo[2,3-d]pyrimidin-7-yl]-5-methyl-tetrahydro-furan-3,4-diol | CHEMBL442003
TypeSmall organic molecule
Emp. Form.C17H17IN4O4
Mol. Mass.468.2458
SMILESC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cc(I)c2c(Nc3ccc(O)cc3)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a