Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSortase family protein
LigandBDBM50537899
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1971675
IC50 34000±n/a nM
Citation Bae, JCho, EPark, JSWon, THSeo, SYOh, DCOh, KBShin, J Isocadiolides A-H: Polybrominated Aromatics from a  J Nat Prod83:429-437 (2020) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sortase family protein
Name:Sortase family protein
Synonyms:Sortase | Sortase A (SrtA)
Type:Enzyme
Mol. Mass.:23546.15
Organism:Staphylococcus aureus
Description:n/a
Residue:206
Sequence:
MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQ
AKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGH
TFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLT
LITCDDYNEKTGVWEKRKIFVATEVK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50537899
NameBDBM50537899
Synonyms:CADIOLIDE D | Cadiolide D
TypeSmall organic molecule
Emp. Form.C24H11Br5O6
Mol. Mass.794.861
SMILESOc1ccc(\C=C2/OC(=O)C(C(=O)c3cc(Br)c(O)c(Br)c3)=C2c2cc(Br)c(O)c(Br)c2)cc1Br |c:22|
Structure
n/a