Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThrombospondin-1
LigandBDBM50541829
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1985421
IC50 15±n/a nM
Citation Suto, MJGupta, VMathew, BZhang, WPallero, MAMurphy-Ullrich, JE Identification of Inhibitors of Thrombospondin 1 Activation of TGF-?. ACS Med Chem Lett11:1130-1136 (2020) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thrombospondin-1
Name:Thrombospondin-1
Synonyms:Glycoprotein G | THBS1 | TSP | TSP1 | Thrombospondin-1
Type:PROTEIN
Mol. Mass.:129327.50
Organism:Homo sapiens
Description:ChEMBL_119903
Residue:1170
Sequence:
MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVV
SNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQI
CNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGSQPFGQGVEHATANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDKDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50541829
NameBDBM50541829
Synonyms:CHEMBL4638959
TypeSmall organic molecule
Emp. Form.C19H35N5O6
Mol. Mass.429.5111
SMILESCC(C)C[C@H](NC(=O)[C@H](CCCCNC(C)=O)NC(=O)[C@H](CO)NC(C)=O)C(N)=O |r|
Structure
n/a