Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine kinase
LigandBDBM50095358
Substrate/Competitorn/a
Meas. Tech.ChEMBL_88738
IC50 467±n/a nM
Citation Lee, CHJiang, MCowart, MGfesser, GPerner, RKim, KHGu, YGWilliams, MJarvis, MFKowaluk, EAStewart, AOBhagwat, SS Discovery of 4-amino-5-(3-bromophenyl)-7-(6-morpholino-pyridin-3-yl)pyrido[2,3-d]pyrimidine, an orally active, non-nucleoside adenosine kinase inhibitor.. J Med Chem44:2133-8 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine kinase
Name:Adenosine kinase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:40545.97
Organism:Homo sapiens (Human)
Description:ChEMBL_1467841
Residue:362
Sequence:
MAAAEEEPKPKKLKVEAPQALRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAED
KHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKA
AEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKAR
VCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGN
ETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFA
VLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPD
FH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50095358
NameBDBM50095358
Synonyms:7-(4-Dimethylamino-phenyl)-5-phenyl-pyrido[2,3-d]pyrimidin-4-ylamine | CHEMBL68492
TypeSmall organic molecule
Emp. Form.C21H19N5
Mol. Mass.341.4091
SMILESCN(C)c1ccc(cc1)-c1cc(-c2ccccc2)c2c(N)ncnc2n1
Structure
n/a