Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUrokinase-type plasminogen activator
LigandBDBM50102775
Substrate/Competitorn/a
Meas. Tech.ChEMBL_226004
Ki 3600±n/a nM
Citation Verner, EKatz, BASpencer, JRAllen, DHataye, JHruzewicz, WHui, HCKolesnikov, ALi, YLuong, CMartelli, ARadika, KRai, RShe, MShrader, WSprengeler, PATrapp, SWang, JYoung, WBMackman, RL Development of serine protease inhibitors displaying a multicentered short (<2.3 A) hydrogen bond binding mode: inhibitors of urokinase-type plasminogen activator and factor Xa. J Med Chem44:2753-71 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Urokinase-type plasminogen activator
Name:Urokinase-type plasminogen activator/surface receptor
Synonyms:U-plasminogen activator | Urokinase | Urokinase-type plasminogen activator (uPA)
Type:Enzyme
Mol. Mass.:48528.62
Organism:Homo sapiens (Human)
Description:P00749
Residue:431
Sequence:
MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHN
YCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKII
GGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLG
RSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL
PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKML
CAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR
SHTKEENGLAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50102775
NameBDBM50102775
Synonyms:2-(2-Hydroxy-4-methyl-phenyl)-1H-benzoimidazole-5-carboxamidine | CHEMBL92865
TypeSmall organic molecule
Emp. Form.C15H14N4O
Mol. Mass.266.2979
SMILESCc1ccc(-c2nc3ccc(cc3[nH]2)C(N)=N)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a