Reaction Details |
 | Report a problem with these data |
Target | Fibroblast growth factor 23 |
---|
Ligand | BDBM50549233 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2024190 |
---|
IC50 | 200±n/a nM |
---|
Citation | Downs, RP; Xiao, Z; Ikedionwu, MO; Cleveland, JW; Lin Chin, A; Cafferty, AE; Darryl Quarles, L; Carrick, JD Design and development of FGF-23 antagonists: Definition of the pharmacophore and initial structure-activity relationships probed by synthetic analogues. Bioorg Med Chem29:0 (2021) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fibroblast growth factor 23 |
---|
Name: | Fibroblast growth factor 23 |
Synonyms: | FGF-23 | FGF23 | Fibroblast growth factor 23 | Fibroblast growth factor 23 C-terminal peptide | Fibroblast growth factor 23 N-terminal peptide | HYPF | Phosphatonin | Tumor-derived hypophosphatemia-inducing factor |
Type: | PROTEIN |
Mol. Mass.: | 27966.65 |
Organism: | Homo sapiens |
Description: | ChEMBL_115874 |
Residue: | 251 |
Sequence: | MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGH
VDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTL
ENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRS
AEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTG
PEGCRPFAKFI
|
|
|
BDBM50549233 |
---|
Name | BDBM50549233 |
Synonyms: | CHEMBL4790497 |
Type | Small organic molecule |
Emp. Form. | C15H17NO |
Mol. Mass. | 227.3016 |
SMILES | Cc1ccc(\C=C\C2=C(CCC2)/C=N/O)cc1 |t:7| |
Structure |  |
n/a |
---|