Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin-1
LigandBDBM50112522
Substrate/Competitorn/a
Meas. Tech.ChEBML_213077
Ki 25±n/a nM
Citation Shaw, KJGuilford, WJGriedel, BDSakata, STrinh, LWu, SXu, WZhao, ZMorrissey, MM Benzimidazole-based fXa inhibitors with improved thrombin and trypsin selectivity. Bioorg Med Chem Lett12:1311-4 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Trypsin-1
Name:Trypsin-1
Synonyms:Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | Trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:26557.80
Organism:Homo sapiens (Human)
Description:P07477
Residue:247
Sequence:
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50112522
NameBDBM50112522
Synonyms:CHEMBL280769 | N-{1-(7-Carbamimidoyl-naphthalen-2-ylmethyl)-2-ethyl-5-[1-(1-imino-ethyl)-piperidin-4-yloxy]-1H-benzoimidazol-4-yl}-acetamide
TypeSmall organic molecule
Emp. Form.C30H35N7O2
Mol. Mass.525.6446
SMILESCCc1nc2c(NC(C)=O)c(OC3CCN(CC3)C(C)=N)ccc2n1Cc1ccc2ccc(cc2c1)C(N)=N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a