Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlasminogen
LigandBDBM50115870
Substrate/Competitorn/a
Meas. Tech.ChEBML_155433
Ki 1600±n/a nM
Citation Mackman, RLHui, HCBreitenbucher, JGKatz, BALuong, CMartelli, AMcGee, DRadika, KSendzik, MSpencer, JRSprengeler, PATario, JVerner, EWang, J 2-(2-Hydroxy-3-alkoxyphenyl)-1H-benzimidazole-5-carboxamidine derivatives as potent and selective urokinase-type plasminogen activator inhibitors. Bioorg Med Chem Lett12:2019-22 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Plasminogen
Name:Plasminogen
Synonyms:Activation peptide | Angiostatin | Plasmin | Plasmin heavy chain A | Plasmin heavy chain A, short form | Plasmin light chain B
Type:Enzyme
Mol. Mass.:90579.18
Organism:Homo sapiens (Human)
Description:n/a
Residue:810
Sequence:
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT
CRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN
GITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILE
CEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRE
LRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWS
AQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTE
QLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEED
CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGG
PWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRT
RFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
PTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQ
LPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW
GLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50115870
NameBDBM50115870
Synonyms:2-(3-Ethoxy-2-hydroxy-phenyl)-1H-benzoimidazole-5-carboxamidine | CHEMBL64838
TypeSmall organic molecule
Emp. Form.C16H16N4O2
Mol. Mass.296.3238
SMILESCCOc1cccc(-c2nc3ccc(cc3[nH]2)C(N)=N)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a