Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTissue-type plasminogen activator
LigandBDBM50115867
Substrate/Competitorn/a
Meas. Tech.ChEBML_208242
Ki 1000±n/a nM
Citation Mackman, RLHui, HCBreitenbucher, JGKatz, BALuong, CMartelli, AMcGee, DRadika, KSendzik, MSpencer, JRSprengeler, PATario, JVerner, EWang, J 2-(2-Hydroxy-3-alkoxyphenyl)-1H-benzimidazole-5-carboxamidine derivatives as potent and selective urokinase-type plasminogen activator inhibitors. Bioorg Med Chem Lett12:2019-22 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tissue-type plasminogen activator
Name:Tissue-type plasminogen activator
Synonyms:Alteplase | Reteplase | Thrombin receptor protein | Tissue-type plasminogen activator | Tissue-type plasminogen activator (tPA) | Tissue-type plasminogen activator precursor | t-PA | t-Plasminogen Activator (tPA) | t-plasminogen activator
Type:Enzyme
Mol. Mass.:62931.08
Organism:Homo sapiens (Human)
Description:n/a
Residue:562
Sequence:
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCR
NPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWN
SMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCG
LRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQ
ERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQH
LLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQK
DVPGVYTKVTNYLDWIRDNMRP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50115867
NameBDBM50115867
Synonyms:2-(2-Hydroxy-3-phenoxy-phenyl)-1H-benzoimidazole-5-carboxamidine | CHEMBL62370
TypeSmall organic molecule
Emp. Form.C20H16N4O2
Mol. Mass.344.3666
SMILESNC(=N)c1ccc2nc([nH]c2c1)-c1cccc(Oc2ccccc2)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a