Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInosine Monophosphate Dehydrogenase Type 2 (IMPDH2)
LigandBDBM50116133
Substrate/Competitorn/a
Meas. Tech.ChEBML_89931
IC50 330±n/a nM
Citation Pitts, WJGuo, JDhar, TGShen, ZGu, HHWatterson, SHBednarz, MSChen, BCBarrish, JCBassolino, DCheney, DFleener, CARouleau, KAHollenbaugh, DLIwanowicz, EJ Rapid synthesis of triazine inhibitors of inosine monophosphate dehydrogenase. Bioorg Med Chem Lett12:2137-40 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Inosine Monophosphate Dehydrogenase Type 2 (IMPDH2)
Name:Inosine-5'-monophosphate dehydrogenase (IMPDH)
Synonyms:IMP dehydrogenase 2 | IMPD 2 | IMPDH-II | Inosine 5'-monophosphate dehydrogenase II (IMPDH II) | Inosine-5 -monophosphate dehydrogenase 2 | Inosine-5''''-monophosphate dehydrogenase 2
Type:Enzyme
Mol. Mass.:55806.87
Organism:Homo sapiens (Human)
Description:Recombinant IMPDH2 expressed in E. coli.
Residue:514
Sequence:
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVV
LSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMT
KREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDA
KKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVI
GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVP
VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVR
AMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50116133
NameBDBM50116133
Synonyms:(3-Methoxy-4-oxazol-5-yl-phenyl)-[4-(4-methyl-piperazin-1-yl)-6-phenyl-[1,3,5]triazin-2-yl]-amine | CHEMBL69527
TypeSmall organic molecule
Emp. Form.C24H25N7O2
Mol. Mass.443.501
SMILESCOc1cc(Nc2nc(nc(n2)-c2ccccc2)N2CCN(C)CC2)ccc1-c1cnco1
Structure
n/a