Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuropeptide Y receptor type 5 ( NPY Y5)
LigandBDBM50116592
Substrate/Competitorn/a
Meas. Tech.ChEMBL_143678
IC50 3±n/a nM
Citation Block, MHBoyer, SBrailsford, WBrittain, DRCarroll, DChapman, SClarke, DSDonald, CSFoote, KMGodfrey, LLadner, AMarsham, PRMasters, DJMee, CDO'Donovan, MRPease, JEPickup, AGRayner, JWRoberts, ASchofield, PSuleman, ATurnbull, AV Discovery and optimization of a series of carbazole ureas as NPY5 antagonists for the treatment of obesity. J Med Chem45:3509-23 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuropeptide Y receptor type 5 ( NPY Y5)
Name:Neuropeptide Y receptor type 5
Synonyms:NPY-Y5 | NPY-Y5 receptor | NPY5-R | NPY5R | NPYY5 | Y5 receptor
Type:Enzyme
Mol. Mass.:50746.64
Organism:Homo sapiens (Human)
Description:Q15761
Residue:445
Sequence:
MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNL
LILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFL
QCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSL
VELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISC
GLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAP
ERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIK
KRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCL
NPILYGFLNNGIKADLVSLIHCLHM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50116592
NameBDBM50116592
Synonyms:CHEMBL325226 | Morpholine-4-carboxylic acid (9-isopropyl-4-methyl-9H-carbazol-3-yl)-amide
TypeSmall organic molecule
Emp. Form.C21H25N3O2
Mol. Mass.351.4421
SMILESCC(C)n1c2ccccc2c2c(C)c(NC(=O)N3CCOCC3)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a