Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFormyl peptide receptor 2
LigandBDBM50559838
Substrate/Competitorn/a
Meas. Tech.ChEMBL_2070443
EC50 0.630000±n/a nM
Citation Asahina, YWurtz, NRArakawa, KCarson, NFujii, KFukuchi, KGarcia, RHsu, MYIshiyama, JIto, BKick, ELupisella, JMatsushima, SOhata, KOstrowski, JSaito, YTsuda, KVillarreal, FYamada, HYamaoka, TWexler, RGordon, DKohno, Y Discovery of BMS-986235/LAR-1219: A Potent Formyl Peptide Receptor 2 (FPR2) Selective Agonist for the Prevention of Heart Failure. J Med Chem63:9003-9019 (2020) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Formyl peptide receptor 2
Name:Formyl peptide receptor 2
Synonyms:Formyl peptide receptor 2 | Formylpeptide receptor-related sequence 2 | Fpr-rs2 | Fpr2 | Lipoxin A4 receptor-like protein | N-formylpeptide receptor-like 2
Type:PROTEIN
Mol. Mass.:39427.03
Organism:Mus musculus
Description:ChEMBL_120178
Residue:351
Sequence:
MESNYSIHLNGSEVVVYDSTISRVLWILSMVVVSITFFLGVLGNGLVIWVAGFRMPHTVT
TIWYLNLALADFSFTATLPFLLVEMAMKEKWPFGWFLCKLVHIVVDVNLFGSVFLIALIA
LDRCICVLHPVWAQNHRTVSLARKVVVGPWIFALILTLPIFIFLTTVRIPGGDVYCTFNF
GSWAQTDEEKLNTAITFVTTRGIIRFLIGFSMPMSIVAVCYGLIAVKINRRNLVNSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWFKETLLSGSYKILDMFVNPTSSLAYFNSCLNPM
LYVFMGQDFRERFIHSLPYSLERALSEDSGQTSDSSTSSTSPPADIELKAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50559838
NameBDBM50559838
Synonyms:CHEMBL4790836
TypeSmall organic molecule
Emp. Form.C19H19F2N3O4
Mol. Mass.391.3687
SMILESCOc1cc(F)c([C@@H]2CNC(=O)[C@H]2NC(=O)Nc2ccc(C)c(O)c2)c(F)c1 |r|
Structure
n/a