Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInosine Monophosphate Dehydrogenase Type 2 (IMPDH2)
LigandBDBM50123355
Substrate/Competitorn/a
Meas. Tech.ChEBML_89930
IC50<5±n/a nM
Citation Dhar, TGWatterson, SHChen, PShen, ZGu, HHNorris, DCarlsen, MHaslow, KDPitts, WJGuo, JChorba, JFleener, CARouleau, KATownsend, RHollenbaugh, DIwanowicz, EJ Quinolone-based IMPDH inhibitors: introduction of basic residues on ring D and SAR of the corresponding mono, di and benzofused analogues. Bioorg Med Chem Lett13:547-51 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Inosine Monophosphate Dehydrogenase Type 2 (IMPDH2)
Name:Inosine-5'-monophosphate dehydrogenase (IMPDH)
Synonyms:IMP dehydrogenase 2 | IMPD 2 | IMPDH-II | Inosine 5'-monophosphate dehydrogenase II (IMPDH II) | Inosine-5 -monophosphate dehydrogenase 2 | Inosine-5''''-monophosphate dehydrogenase 2
Type:Enzyme
Mol. Mass.:55806.87
Organism:Homo sapiens (Human)
Description:Recombinant IMPDH2 expressed in E. coli.
Residue:514
Sequence:
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVV
LSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMT
KREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDA
KKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVI
GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVP
VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVR
AMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50123355
NameBDBM50123355
Synonyms:2-(3-Dimethylamino-indan-5-yl)-7-methoxy-6-oxazol-5-yl-1H-quinolin-4-one | CHEMBL422508
TypeSmall organic molecule
Emp. Form.C24H23N3O3
Mol. Mass.401.4577
SMILESCOc1cc2nc(cc(O)c2cc1-c1cnco1)-c1ccc2CCC(N(C)C)c2c1
Structure
n/a