Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInosine Monophosphate Dehydrogenase Type 2 (IMPDH2)
LigandBDBM50133730
Substrate/Competitorn/a
Meas. Tech.ChEBML_89932
IC50 266±n/a nM
Citation Dhar, TGShen, ZGu, HHChen, PNorris, DWatterson, SHBallentine, SKFleener, CARouleau, KABarrish, JCTownsend, RHollenbaugh, DLIwanowicz, EJ 3-cyanoindole-based inhibitors of inosine monophosphate dehydrogenase: synthesis and initial structure-activity relationships. Bioorg Med Chem Lett13:3557-60 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Inosine Monophosphate Dehydrogenase Type 2 (IMPDH2)
Name:Inosine-5'-monophosphate dehydrogenase (IMPDH)
Synonyms:IMP dehydrogenase 2 | IMPD 2 | IMPDH-II | Inosine 5'-monophosphate dehydrogenase II (IMPDH II) | Inosine-5 -monophosphate dehydrogenase 2 | Inosine-5''''-monophosphate dehydrogenase 2
Type:Enzyme
Mol. Mass.:55806.87
Organism:Homo sapiens (Human)
Description:Recombinant IMPDH2 expressed in E. coli.
Residue:514
Sequence:
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVV
LSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMT
KREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDA
KKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVI
GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVP
VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVR
AMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50133730
NameBDBM50133730
Synonyms:Acetic acid ({2-[2-(3-cyano-1-methyl-1H-indol-6-ylamino)-oxazol-5-yl]-phenyl}-methyl-carbamoyl)-methyl ester | CHEMBL116596
TypeSmall organic molecule
Emp. Form.C24H21N5O4
Mol. Mass.443.4546
SMILESCN(C(=O)COC(C)=O)c1ccccc1-c1cnc(Nc2ccc3c(cn(C)c3c2)C#N)o1
Structure
n/a