Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin K
LigandBDBM50138867
Substrate/Competitorn/a
Meas. Tech.ChEMBL_48338
IC50 470±n/a nM
Citation Tavares, FXBoncek, VDeaton, DNHassell, AMLong, STMiller, ABPayne, AAMiller, LRShewchuk, LMWells-Knecht, KWillard, DHWright, LLZhou, HQ Design of potent, selective, and orally bioavailable inhibitors of cysteine protease cathepsin k. J Med Chem47:588-99 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin K
Name:Cathepsin K
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:36798.82
Organism:Rattus norvegicus
Description:ChEMBL_633322
Residue:329
Sequence:
MWVFKFLLLPVVSFALSPEETLDTQWELWKKTHGKQYNSKVDEISRRLIWEKNLKKISVH
NLEASLGAHTYELAMNHLGDMTSEEVVQKMTGLRVPPSRSFSNDTLYTPEWEGRVPDSID
YRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVSENYGCGGG
YMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVA
RVGPVSVSIDASLTSFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGNKYWIIKNSWGE
SWGNKGYVLLARNKNNACGITNLASFPKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50138867
NameBDBM50138867
Synonyms:CHEMBL157911 | [(S)-1-(2-Pyridin-4-yl-2H-pyrazol-3-ylaminooxalyl)-pentyl]-carbamic acid 1-isopropyl-2-methyl-propyl ester
TypeSmall organic molecule
Emp. Form.C23H33N5O4
Mol. Mass.443.5392
SMILESCCCC[C@H](NC(=O)OC(C(C)C)C(C)C)C(=O)C(=O)Nc1ccnn1-c1ccncc1
Structure
n/a