Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin K
LigandBDBM50138875
Substrate/Competitorn/a
Meas. Tech.ChEMBL_45540
IC50 27±n/a nM
Citation Tavares, FXBoncek, VDeaton, DNHassell, AMLong, STMiller, ABPayne, AAMiller, LRShewchuk, LMWells-Knecht, KWillard, DHWright, LLZhou, HQ Design of potent, selective, and orally bioavailable inhibitors of cysteine protease cathepsin k. J Med Chem47:588-99 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin K
Name:Cathepsin K
Synonyms:CTSK | CTSO | CTSO2 | Cathepsin O | Cathepsin O2 | Cathepsin X
Type:Enzyme
Mol. Mass.:36975.68
Organism:Homo sapiens (Human)
Description:P43235
Residue:329
Sequence:
MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVD
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGG
YMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE
NWGNKGYILMARNKNNACGIANLASFPKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50138875
NameBDBM50138875
Synonyms:CHEMBL152634 | {(S)-1-Benzyl-2-oxo-2-[(thiophen-2-ylmethyl)-carbamoyl]-ethyl}-carbamic acid 1-isopropyl-2-methyl-propyl ester
TypeSmall organic molecule
Emp. Form.C23H30N2O4S
Mol. Mass.430.56
SMILESCC(C)C(OC(=O)N[C@@H](Cc1ccccc1)C(=O)C(=O)NCc1cccs1)C(C)C
Structure
n/a