Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium-dependent serotonin transporter
LigandBDBM50139955
Substrate/Competitorn/a
Meas. Tech.ChEMBL_201479
Ki 0.11±n/a nM
Citation Plisson, CMcConathy, JMartarello, LMalveaux, EJCamp, VMWilliams, LVotaw, JRGoodman, MM Synthesis, radiosynthesis, and biological evaluation of carbon-11 and iodine-123 labeled 2beta-carbomethoxy-3beta-[4'-((Z)-2-haloethenyl)phenyl]tropanes: candidate radioligands for in vivo imaging of the serotonin transporter. J Med Chem47:1122-35 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sodium-dependent serotonin transporter
Name:Monoamine transporter
Synonyms:5-HT Transporter | 5HT transporter | 5HTT | SERT | SLC6A4 | Serotonin Transporter (SERT) | Serotonin transporter (5HTT) | Serotonin transporter protein (SERT) | Sodium-dependent serotonin transporter (SERT) | Solute carrier family 6 member 4
Type:Multi-pass membrane protein
Mol. Mass.:70322.51
Organism:Homo sapiens (Human)
Description:P31645
Residue:630
Sequence:
METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTR
HSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM
AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIH
RSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGA
TLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVT
LTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIIT
PGTFKERIIKSITPETPTEIPCGDIRLNAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50139955
NameBDBM50139955
Synonyms:3-[4-((Z)-2-Iodo-vinyl)-phenyl]-8-methyl-8-aza-bicyclo[3.2.1]octane-2-carboxylic acid methyl ester | CHEMBL275212 | methyl 3-{4-[(Z)-2-iodovinyl]phenyl}-8-methyl-8-azabicyclo[3.2.1]octane-2-carboxylate
TypeSmall organic molecule
Emp. Form.C18H22INO2
Mol. Mass.411.2773
SMILESCOC(=O)C1C2CCC(CC1c1ccc(\C=C/I)cc1)N2C |TLB:21:20:6.7:9.4.10,THB:2:4:6.7:20|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a